NAD+ salvage raises a handful of sensible questions. This page answers them in order, starting with the fundamentals and moving to applications.
This page was last updated on 2026-02-13 and is reviewed periodically as new material appears.
Chemically, NMN is described by the molecular formula C11H15N2O8P and a molecular mass near 334.22 g/mol. The beta anomer has a CAS Registry Number of 1094-61-7. It is typically supplied as a white to off-white powder for laboratory use. The molecule carries a phosphate group and a positively charged nicotinamide ring, giving it polar and water-soluble character. These properties influence how it is detected, purified, and stored in research and analytical laboratories.
Nicotinamide mononucleotide, abbreviated NMN, is a nucleotide composed of nicotinamide, ribose, and phosphate. Its structure links nicotinamide to D-ribose 5-phosphate through a glycosidic bond, placing it in the pyridine nucleotide family. The compound exists in alpha and beta anomeric forms, and the beta form is the one used in NAD+ biosynthesis. NMN is not a protein or a hormone; it is a small water-soluble molecule that occurs in living cells as a metabolic intermediate.
Natural sources of NMN include mammals, plants, and microorganisms, where it functions as an intermediate in NAD+ salvage and biosynthesis pathways. In mammals, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. NMN is then converted to NAD+ by nicotinamide mononucleotide adenylyltransferase. Some foods contain measurable NMN, but reported amounts vary widely by species, tissue, and analytical method. The extent to which dietary NMN contributes to cellular NAD+ pools remains an open research question.
Analytical measurement of NMN typically uses high-performance liquid chromatography with ultraviolet detection, often at a wavelength near 260 nanometers. Liquid chromatography coupled with tandem mass spectrometry provides greater sensitivity and specificity, especially for biological samples. Nuclear magnetic resonance spectroscopy can confirm structure and detect certain impurities. Purity values reported by suppliers depend on the analytical method, calibration standards, and whether related compounds such as nicotinamide or NAD+ are included in the calculation. Independent verification is useful because supplement labels may not fully describe the tested material.
Regulatory treatment of NMN differs by country and has changed over time. In the United States, the Food and Drug Administration has stated that NMN is excluded from the definition of a dietary supplement because it was investigated as a drug before being marketed as a supplement; enforcement and legal interpretation continue to evolve. In the European Union, NMN may require authorization as a novel food before sale. In Japan, NMN has been marketed in some food products, while it is not approved as a therapeutic drug in major markets. These categories affect labeling, permitted claims, and quality oversight.
| Property | Value | Notes |
|---|---|---|
| Common name | Nicotinamide mononucleotide | Often abbreviated NMN |
| Chemical formula | C11H15N2O8P | Beta anomer form |
| Molecular mass | 334.22 g/mol | Calculated from formula |
| CAS Registry Number | 1094-61-7 | Beta-NMN |
| Appearance | White to off-white powder | Typical laboratory grade |
Terminology around NMN can be confusing because several related compounds share the vitamin B3 family. Nicotinamide riboside is a nucleoside, whereas NMN is a nucleotide with a phosphate group, and NAD+ is a dinucleotide coenzyme rather than a simple precursor. Niacin and nicotinamide are also NAD+ precursors but follow different metabolic entry points. In commercial and scientific writing, NMN usually refers to beta-nicotinamide mononucleotide unless another form is specified. Consistent nomenclature helps distinguish chemical identity from proposed biological effects.
Nicotinamide mononucleotide, commonly abbreviated NMN, is a pyridine nucleotide that consists of a nicotinamide ring, a ribose sugar, and a phosphate group. It is an intermediate in the salvage pathway for nicotinamide adenine dinucleotide, or NAD+, synthesis. In mammalian cells, the enzyme nicotinamide phosphoribosyltransferase produces NMN from nicotinamide and phosphoribosyl pyrophosphate. Nicotinamide mononucleotide adenylyltransferases then convert NMN into NAD+. The core structure and enzymatic route are well established in biochemical literature.
Stability of NMN depends on physical form, temperature, moisture, light, and pH. The solid compound is generally more stable than aqueous solutions, which can degrade over time, especially when warm or exposed to extreme pH. Recommended laboratory storage is typically desiccated at −20 °C or below, protected from light, with containers sealed to limit moisture uptake. In solution, degradation products may include nicotinamide and related ribosides, and the rate varies with buffer composition and concentration. Analytical laboratories often prepare fresh solutions and validate stability for each method.
Quality control for NMN materials usually covers identity, assay purity, residual solvents, heavy metals, microbial limits, and moisture content. Certificates of analysis from suppliers may report high-performance liquid chromatography purity, mass spectrometry identity, and elemental impurity testing. Regulatory treatment differs by country: NMN is not an approved drug, and its status as a dietary supplement ingredient or novel food has been debated. Some authorities have restricted sales pending safety and regulatory review, while others allow it under specific categories. Buyers should verify documentation rather than rely on label claims.
In an experiment described in the 2016 paper, rhesus macaques were infected with Ebola virus and treated with a combination of ansuvimab and another antibody isolated from the same subject, mAb100. Three doses of the combination were given once a day starting 1 day after the animals were infected. The control animal died and the treated animals all survived. In a second experiment described in the 2016 paper, rhesus macaques were infected with Ebola virus and only treated with ansuvimab. Three doses of ansuvimab were given once a day starting 1 day or 5 days after the animals were infected. The control animals died and the treated animals all survived. Unpublished data referred to in a publication of the 2018 Phase I clinical trial results of ansuvimab, reported that a single infusion of ansuvimab provided full protection of rhesus macaques and was the basis of the dosing used for human studies.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Gary J. Patti is an American biochemist known for his research in metabolism and for using mass spectrometry to characterize biological processes. He is the Michael and Tana Powell Professor at Washington University in St. Louis. He is co-founder and Chief Scientific Officer of Panome Bio and an Associate Editor for Clinical & Translational Metabolism. Biemann Medal, 2024 ACS Midwest Award, 2023 Academy of Science Innovation Award, 2016 Edward Mallinckrodt Jr. Scholar Award, 2016 Pew Biomedical Scholars Award, 2015 Alfred P. Sloan Award, 2014 Camille Dreyfus Teacher-Scholar Award, 2014 Gary Patti publications indexed by Google Scholar
Alza Corporation was an American pharmaceutical and medical systems company. Founded in 1968 by Dr. Alejandro Zaffaroni; the company's name is a portmanteau of his name. Alza was a major pioneer in the field of drug delivery systems, bringing over 20 prescription pharmaceutical products to market, and employing about 10,000 people during 20 years. In 2001, Alza was acquired by Johnson & Johnson via a stock-for-stock transaction worth US$10.5 billion. The company owns the patents on the following delivery platforms: Alzamer Depot D-Trans DUROS implant E-Trans electrotransport OROS (Osmotic Release Oral System) Macroflux transdermal system Stealth liposomal
Sources: en.wikipedia.org
2-Oleoylglycerol (2OG) is a monoacylglycerol that is found in biologic tissues. Its synthesis is derived from diacylglycerol precursors. It is metabolized to oleic acid and glycerol primarily by the enzyme monoacylglycerol lipase (MAGL). In 2011, 2OG was found to be an endogenous ligand to GPR119. 2OG has been shown to increase glucagon-like peptide-1 (GLP-1) and gastric inhibitory polypeptide (GIP) levels following administration to the small intestine. 2OG has also been discovered to potentiate G protein and not β-arrestin signaling via allosteric binding of the 5-HT2A receptor. 2-Arachidonoylglycerol JZL184
While APHL primarily focuses on public health laboratories in the United States, their global health program makes an effort to help other countries strengthen their own laboratory practices.APHL works with more than 30 countries to: Share effective testing procedures Develop laboratory policies Improve the quality of data Train laboratory leaders Utilize information management systems Create strategies to monitor and detect Establish emergency response programs Design training programs APHL also works with public health laboratories around the world to share information on global health crises and promotes cross-border collaboration.
3-Dehydrocarnitine has a role as a human metabolite, as it is an intermediate of the degradation of carnitine. Carnitine is utilized in the transport of fatty acids from the cytosol into the mitochondria of living cells during the breakdown of fatty acids for the generation of metabolic energy. In humans, 3-dehydrocarnitine is found in the blood, saliva, urine, and feces. In patients with colorectal cancer, elevated levels of 3-dehydrocarnitine have been detected, possibly due to the elevated rate of metabolism seen in malignant cancer cells. 3-Dehydrocarnitine is also found exogenously in multiple sources of food, such as poultry, lagomorph, sheep, goat, beef, venison, equine, and pork. This indicates its presence in the animals the food is derived from. 3-Dehydrocarnitine is also present in mice and Apis cerana. It is found as a metabolite in aging mouse brains, and is found as a product of Apis cerana.
To enhance sensitivity, the secondary capillary of the nano-DESI probe can be equipped with a nebulizer, which takes benefit of the Venturi effect, facilitating the aspiration of the liquid. This enables the secondary probe to be longer, while still maintaining stable electrospray, thereby simplifying the setup process. Moreover, it offers greater versatility in nano-DESI solvent selection, allowing water to be used as an extraction solvent. This expands the technique’s chemical coverage and enhances the customization of solvent components for selective extraction of polar compounds. Additionally, the capillaries can be integrated into a custom 3D-printed cassette, creating a convenient plug-and-play device.
ADAMTS7 was identified as a protease that binds and cleaves COMP in a yeast two-hybrid screen using the epidermal growth factor (EGF) domain of COMP as the bait. However, this initial finding has been contested; a 2025 study demonstrated that purified ADAMTS7 does not exhibit proteolytic cleavage activity toward purified COMP. Furthermore, three independent unbiased N-terminal amine isotopic labeling of substrates (N-TAILS) proteomic studies identified a number of candidate substrates for ADAMTS7 but did not identify COMP as a potential substrate. Consequently, there is as yet no scientific consensus on the physiological function of ADAMTS7. Tissue inhibitor of metalloproteinases 4 (TIMP-4) appears to be the physiological inhibitor of ADAMTS7.
Sources: en.wikipedia.org
Gympietides are a peptide family of neurotoxins that target pain receptors and permanently change and inactivate voltage-gated sodium channels in sensory neurons to produce long-lasting pain. The highly stable nature of these peptides means that they can repeatedly stimulate these sensory neurons, prolonging the pain. Their 3D molecular structure makes Gympietides similar to spider or cone snail toxins. The species Dendrocnide moroides produces gympietides. These toxins give D. moroides its notoriously painful toxic stings, which can last from a few hours up to a year. Dendrocnide excelsa also produces gympietides. They get their name after the species of plant Dendrocnide moroides, commonly known as gympie-gympie. All known gympietides have a very similar primary structure. The tertiary structure of Excelsatoxin A was determined via NMR spectroscopy, showing a cystine-knot structure. The other members of the family are predicted to have very similar 3D structures.
Different active sites are bonded by agonist and antagonist, which means the antagonist obstructs the chain of events that triggers the agonist to produce a response at a point downstream from the agonist binding site on the receptor. It irreversibly binds to the active site. One examples is when Ketamine enters the NMDA receptor's ion channel pore and blocks it, stopping ions from passing through the channels. Also, medication like nifedipine and verapamil stops Ca2+ from entering the cell membrane and so non-selectively prevent medications that act at any receptor that binds to these calcium channels from causing smooth muscle contraction.
The 2025 Cleveland Guardians season was the 125th season for the franchise, which competes in the American League of Major League Baseball (MLB). On July 6, they were 15.5 games back of the first place Detroit Tigers and were as many as 11 games back on September 4. However, the Guardians surged while the Tigers collapsed and took the American League Central lead on September 23 with a win over the Tigers. With the Guardians having trailed Detroit by 15.5 games in July, this ranked as the largest divisional comeback in MLB history. In addition to the historic division comeback, the Guardians also became the fifth team to make the playoffs while being sub-.500 on September 4 or later. On September 27, with a walk-off win over the Texas Rangers, the Guardians clinched a postseason berth, taking the sixth and final postseason spot in the American League. On September 28, with the Tigers' loss to the Red Sox, the Guardians clinched the American League Central division for the second consecutive time and the sixth time in ten years (2016–2018, 2022, 2024–2025). However, they lost to the Tigers in the Wild Card Series.
Cytochrome-b5 reductase is a NADH-dependent enzyme that converts ferricytochrome from a Fe3+ form to a Fe2+ form. It contains FAD and catalyzes the reaction: In its b5-reducing capacity, this enzyme is involved in desaturation and elongation of fatty acids, cholesterol biosynthesis, and drug metabolism. This enzyme can also reduce methemoglobin to normal hemoglobin, gaining it the inaccurate synonym methemoglobin reductase. Isoforms expressed in erythrocytes (CYB5R1, CYB5R3) perform this function in vivo. Ferricyanide is another substrate in vitro.
Sources: en.wikipedia.org
NMN stands for nicotinamide mononucleotide. It is a naturally occurring nucleotide and an intermediate in NAD+ biosynthesis.
No. NMN is a precursor that can be converted to NAD+ in cells. NAD+ is the larger dinucleotide that participates in many redox reactions.
Small amounts of NMN have been reported in several foods, including certain vegetables and fruits. The measured levels vary, and the significance of dietary intake is not fully established.
Solid NMN is commonly stored frozen at about minus 20 degrees Celsius, sealed against moisture, and protected from light. Solutions are typically prepared fresh because they can degrade more quickly. Specific storage conditions can vary by supplier and intended use.