Everything below concerns copper tripeptide-1. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Last reviewed on 2025-08-07. Where a claim depends on a specific study, the study is described rather than over-claimed.
Endogenous GHK occurs in blood plasma, saliva, and urine, and reported plasma concentrations decline with age in several studies. Researchers have proposed that the peptide acts as a copper carrier that delivers the metal to cells and to sites of injury. That transport role is a hypothesis supported by binding measurements and tissue-distribution data rather than a settled mechanism, and the peptide is generally described as a minor contributor to total plasma copper transport. Values reported in wound fluid and certain tissue extracts are higher than in circulating plasma.
The sequence carries three residues in the order glycine, histidine, lysine, which places a small, flexible chain around a single metal centre. Compared with larger copper-binding proteins, the complex is compact and its coordination chemistry can be reproduced with synthetic peptide in a laboratory. Published structural work agrees on the nitrogen donor set but differs in the exact geometry assigned under some conditions, so the arrangement is best treated as well characterised in outline rather than fixed in every detail.
The tripeptide was first isolated from a human plasma filtrate in 1973 during studies of tissue repair factors. Later work detected the free peptide and its copper complex in saliva, urine, and wound fluid, suggesting a natural role in tissue remodeling. Plasma concentrations reported in early literature decline with age, a pattern often cited in discussions of skin aging. Whether these endogenous levels are directly functional or largely incidental remains an open question. The peptide sequence is conserved across mammalian species.
Material described in research and cosmetic supply chains is typically a synthetic peptide supplied as a lyophilized powder. Purity is commonly reported through chromatographic separation, often at 95 percent or higher, while copper content is confirmed by separate elemental analysis. Batch variation in color and solubility can reflect residual counter-ions, moisture, or partial oxidation of the peptide. Because the complex is not a single regulatory entity, specifications differ between suppliers and are not standardized internationally.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II)-tripeptide complex | One peptide ligand with one coordinated metal centre |
| Peptide sequence | Gly-His-Lys | Three residues written in one-letter notation |
| Free peptide mass | 340.4 g/mol | Metal-free GHK; the complex has a higher mass |
| Appearance | Blue to violet solid or solution | Colour originates from copper d orbital transitions |
| Storage | Desiccated, -20 °C, protected from light | Dry powder is more stable than dissolved material |
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide backbone consists of glycine, histidine, and lysine joined in that order. Copper is held through the imidazole nitrogen of histidine and the alpha-amino group at the N-terminus, which together produce a square-planar arrangement around the metal center. The solid appears blue to violet, a color that originates from d-d electronic transitions within the copper coordination sphere. The complex is indexed under CAS number 89030-95-5.
The sequence now called GHK was first reported in the early 1970s after isolation from human plasma, where it was noted to influence liver cell behavior in laboratory preparations. Later work described a copper-binding form and its activity in fibroblast and wound-model experiments. Review articles frequently group the substance with other copper peptides. Concentrations in blood appear to fall with age in several small surveys, although the reason for this trend is not settled. Whether such a decline carries functional consequences remains an open question.
Handling practices for the solid material emphasise low temperature and dryness. The lyophilised or powdered form is typically kept at refrigerator or freezer temperatures together with a desiccant. Working solutions are often prepared fresh, because repeated freeze-thaw cycles and extended storage may alter the complex. Glass or inert plastic containers are preferred over materials that could leach metal ions into the preparation. Such practices follow general peptide conventions rather than substance-specific regulations.
Analytical verification commonly relies on high-performance liquid chromatography for purity assessment and mass spectrometry for identity confirmation. Spectroscopic methods such as UV-visible absorption and electron paramagnetic resonance can probe the metal centre itself, since the d9 configuration of copper(II) produces characteristic signals. Elemental analysis or plasma-based techniques quantify copper content. Because each method reports a different aspect of the same sample, purity figures are most meaningful when the technique and its detection wavelength are stated alongside the value.
Stability of the complex in solution depends on pH, temperature, and the presence of competing ligands. It is generally described as more resistant to breakdown than the metal-free chain, since coordination reduces susceptibility to enzymatic attack. Oxidation and hydrolysis can nevertheless proceed over time in aqueous media. Storage guidance in laboratory settings commonly involves refrigeration, protection from light, and avoidance of strongly alkaline conditions. Published data on long-term behaviour vary considerably and depend on the specific matrix.
Quality control for GHK-Cu relies on documentation and independent testing rather than a single accepted standard. A certificate of analysis may report peptide purity, copper content, residual solvents, water content, and microbial limits, but the underlying methods and acceptance criteria vary by supplier. Verification can include mass confirmation, amino acid analysis, and comparison with a reference standard when one is available. Open questions include how different copper-binding modes or peptide isomers affect measured activity and whether conventional purity assays capture those differences. Buyers of research-grade material typically need to request raw data rather than rely solely on a summary certificate.
Laboratory characterization of GHK-Cu typically combines separation, spectroscopic, and elemental techniques. Reverse-phase high-performance liquid chromatography is widely used to assess peptide purity, often with ultraviolet detection near the copper-related absorption band or with mass spectrometry for identity confirmation. Because the molecule contains copper, elemental methods such as inductively coupled plasma mass spectrometry or atomic absorption spectroscopy are used to quantify metal content and confirm stoichiometry. No single universal pharmacopeial monograph exists for GHK-Cu. Laboratories therefore validate their own methods, and reported purity values depend on the chosen assay and calibration standards.
Stability of GHK-Cu is influenced by light, oxygen, moisture, pH, and temperature. Solid material is generally kept desiccated and frozen to reduce hydrolysis and oxidation, while aqueous solutions are best prepared fresh or stored cold in aliquots. Repeated freeze-thaw cycles can promote aggregation, precipitation, or peptide degradation. Copper coordination may change under strongly acidic or alkaline conditions, potentially altering the complex's spectroscopic properties. Published long-term stability data for specific matrices, such as cosmetic emulsions or biological buffers, are limited, so shelf-life claims should be treated as formulation-specific rather than universal.
Solid material is typically kept as a lyophilised powder in a sealed, light-protected container at minus 20 degrees Celsius, with desiccant where humidity is high. Working solutions are often prepared fresh, aliquoted and frozen to avoid repeated freeze-thaw cycles. Glassware and buffers are checked for trace metal contamination, since other transition metals can displace copper. Records of lot number, reconstitution date and storage temperature help trace unexpected colour changes. Blue colour itself is not a reliable purity test, because partly degraded solutions can remain visibly coloured.
Identity and purity are normally checked by reversed-phase high-performance liquid chromatography, often coupled to mass spectrometry. The peptide absorbs in the ultraviolet region, and the copper complex also shows a broad visible absorption band that can be followed spectroscopically. Copper content is measured separately, for example by inductively coupled plasma mass spectrometry or atomic absorption spectroscopy, because the peptide assay alone does not confirm how much metal is bound. Purity figures therefore need a stated basis: peptide peak area, copper content, or both.
== Further reading == Nakamoto, Satoshi (31 October 2008). "Bitcoin: A Peer-to-Peer Electronic Cash System" (PDF). bitcoin.org. Archived from the original (PDF) on 20 March 2014. Retrieved 28 April 2014.
=== LFA-1 and LFA-3–based therapeutics for autoimmune disease === Although Springer made the first antibodies to LFA-1 and LFA-3, he did not patent them. An antibody isolated by Hildreth and McMichael was licensed to Genentech, which was humanized and approved by the FDA in 2003 for moderate to severe psoriasis as Raptiva. Its generic name efalizumab simulate the letters F and L in LFA-1. Springer and lab member Mike Dustin collaborated with Barbara Wallner at Biogen to clone the cDNA for LFA-3. The LFA-3 ectodomain, which contains one immunoglobulin-like domain, was fused to the Fc domain of IgG to create Amevive. Amevive was approved for moderate to severe psoriasis in 2003. Its generic name, alefacept, is a homophone of LFA plus "cept" from receptor. Royalties paid by Biogen to Dana Farber Cancer Institute were equally shared by Dustin and Springer.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Increased rates of immune system disorders and other wide-ranging symptoms, including chronic pain, fatigue and memory loss, have been reported in over one quarter of combat veterans of the 1991 Gulf War. Combustion products from depleted uranium munitions are being considered as one of the potential causes by the Research Advisory Committee on Gulf War Veterans' Illnesses, as DU was used in 30 mm and 25 mm cannon rounds on a large scale for the first time in the Gulf War. Veterans of the conflicts in the Persian Gulf, Bosnia and Kosovo have been found to have up to 14 times the usual level of chromosome abnormalities in their genes. Serum-soluble genotoxic teratogens produce congenital disorders, and in white blood cells causes immune system damage. A 2005 epidemiology review concluded: "In aggregate the human epidemiological evidence is consistent with increased risk of birth defects in offspring of persons exposed to DU." A 2001 study of 15,000 February 1991 U.S. Gulf War combat veterans and 15,000 control veterans found that the Gulf War veterans were 1.8 (fathers) to 2.8 (mothers) times as likely to have children with birth defects. After examination of children's medical records two years later, the birth defect rate increased by more than 20%:
Sources: en.wikipedia.org
== History == Cambrex was founded in 1979, when the Ennis Family acquired the castor oil and derivatives product lines from NL Industries. In 1987, CasChem was renamed Cambrex Corporation and became listed on NASDAQ. In 1990, Cambrex was listed on the NYSE. Cambrex entered the pharmaceutical market in 1994 with the acquisition of Nobel Pharma Chemistry business, now known as Cambrex Karlskoga AB and Cambrex Profarmaco. Through multiple acquisitions during the late 1990s, the firm entered the bioscience and the chiral enzymatic catalyst markets. Cambrex acquired two contract biopharmaceutical manufacturing facilities in 2001, to bulk manufacture biologics and pharmaceutical ingredients from clinical to commercial scales. In 2007, the firm decided to focus on its core competencies and sold the biologics business to Lonza Group. In 2008, Prosyntest (now Cambrex Tallinn) was acquired, and Steve Klosk was appointed CEO, while remaining President. To broaden their biocatalysis platform, Cambrex acquired IEP in 2010, now known as Cambrex IEP. In 2019, Cambrex acquired Avista Pharma Solutions for $252m to become a fully integrated CDMO. In late 2019, Cambrex was acquired by an affiliate of the Permira funds. In 2020, Cambrex completed a major expansion at its Edinburgh, UK facility known for solid form screening alongside a biopharmaceutical expansion at its Durham, NC facility. Thomas Loewald was appointed CEO of Cambrex in September 2020. In 2022, Cambrex acquired Q1 Scientific, based out of Waterford, Ireland.
=== Rotator cuff disease === A 2022 review and meta-analysis showed improved patient-rated outcomes in patients with partial rotator cuff tears. At 8 weeks post injection, they found PRP to be effective. A 2021 prospective study examined the effectiveness of PRP for partial thickness rotator cuff tears. Patients were given 2 separate PRP injections and followed for 2 years. The study noted: "No adverse events were seen in any patient. Based on global rating scores positive results were seen in 77.9 % of patients at 6 months, 71.6 % at 1 year, and 68.8 % of patients at 2 years". They found PRP most effective in more damaged tendons. A 2021 meta-analysis found that PRP was effective for partial rotator cuff tears but the effects were no longer evident at 1 year. PRP has been shown to be superior to cortisone injections in several studies. This is especially evident in the longer term. A 2019 review found it not to be useful in rotator cuff disease. A 2018 review found that it may be useful. A 2009 review found few randomized controlled trials that adequately evaluated the safety and efficacy of PRP treatments and concluded that PRP was "a promising, but not proven, treatment option for joint, tendon, ligament, and muscle injuries".
For human and animal health, both the FDA and the EC have regulated the content levels of toxins in food and animal feed. Fusaric acid Fusarochromanone Kojic acid Lolitrem B Moniliformin 3-Nitropropionic acid Nivalenol Ochratoxins – In Australia, The Limit of Reporting (LOR) level for ochratoxin A (OTA) analyses in 20th Australian Total Diet Survey was 1 μg/kg, whereas the EC restricts the content of OTA to 5 μg/kg in cereal commodities, 3 μg/kg in processed products and 10 μg/kg in dried vine fruits. Oosporeine Patulin – Currently, this toxin has been advisably regulated on fruit products. The EC and the FDA have limited it to under 50 μg/kg for fruit juice and fruit nectar, while limits of 25 μg/kg for solid-contained fruit products and 10 μg/kg for baby foods were specified by the EC. Phomopsins Sporidesmin A Sterigmatocystin Tremorgenic mycotoxins – Five of them have been reported to be associated with molds found in fermented meats. These are fumitremorgen B, paxilline, penitrem A, verrucosidin, and verruculogen. Trichothecenes – sourced from Cephalosporium, Fusarium, Myrothecium, Stachybotrys, and Trichoderma. The toxins are usually found in molded maize, wheat, corn, peanuts and rice, or animal feed of hay and straw. Four trichothecenes, T-2 toxin, HT-2 toxin, diacetoxyscirpenol (DAS), and deoxynivalenol (DON) have been most commonly encountered by humans and animals. The consequences of oral intake of, or dermal exposure to, the toxins will result in alimentary toxic aleukia, neutropenia, aplastic anemia, thrombocytopenia and/or skin irritation.
Sources: en.wikipedia.org
It consists of a three-amino-acid peptide, glycine-histidine-lysine, bound to one copper(II) ion. The peptide supplies four nitrogen donor atoms, and the resulting complex is stable in neutral aqueous solution. The metal-free peptide is usually called GHK.
The three letters are the standard one-letter codes for glycine, histidine, and lysine. The suffix -Cu indicates the coordinated copper ion. Cosmetic ingredient lists often use the alternative name copper tripeptide-1 for the same complex.
No. Free GHK is the peptide alone, while GHK-Cu contains a bound copper atom. The two differ in colour, charge, and binding behaviour, so any study that measures copper delivery must state which form was used.
It is a complex of the tripeptide glycyl-L-histidyl-L-lysine with a copper(II) ion. The peptide coordinates the metal through its histidine, amino terminus, and an amide nitrogen. It is often listed simply as copper tripeptide-1.