The short version of copper tripeptide fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-05-27. Anything still debated is marked as such rather than presented as settled.
The International Nomenclature of Cosmetic Ingredients lists the substance as copper tripeptide-1, the name that appears on most topical product labels. Related designations include copper peptide and GHK-Cu, and the hyphenated form is common in research literature. In cosmetics the material is regulated as an ingredient rather than as a drug, so products may reach the market without evidence of the effects claimed for them. Whether those effects are clinically meaningful is an open question, since most supportive data come from laboratory work and small trials.
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence found naturally in human plasma, saliva and urine. Loren Pickart reported the isolation of the free peptide in 1973 while studying factors that influenced the growth of aged liver cells in culture. The peptide was later shown to bind copper(II) with high affinity, and the metal-bound form became the focus of most subsequent research. Its concentration in circulation declines markedly with age, a pattern that is well documented, though the physiological consequences of that decline remain debated.
The compound was first isolated from human plasma by the biochemist Loren Pickart in 1973. Early work identified it as a factor that altered the behavior of cultured liver cells, and later studies linked it to connective tissue and wound-related processes. Reported plasma concentrations fall markedly between roughly age twenty and age sixty, a pattern that generated interest in copper peptide biology. Whether that decline has functional consequences remains an open question, because differences observed across age groups do not by themselves establish causation. Research interest later expanded into cosmetic and tissue-culture settings.
Mechanistic accounts focus on how the complex delivers copper and how the released peptide interacts with the extracellular matrix. Copper is an essential cofactor for lysyl oxidase and other enzymes involved in collagen and elastin cross-linking, and GHK is one of several peptides able to carry the metal. Reported effects include altered gene expression in fibroblasts and changes in matrix metalloproteinase activity, although many of these findings come from cell culture rather than whole organisms. The relative contribution of the peptide backbone, the copper ion, and downstream copper metabolism is not fully resolved.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-lysine and a copper(II) ion. The peptide sequence is conventionally written as Gly-His-Lys, abbreviated GHK. Copper binds through the imidazole nitrogen of histidine, the alpha-amino group, and a deprotonated amide nitrogen, producing a square-planar geometry. The complex carries a net positive charge near physiological pH and is intensely blue in aqueous solution. The metal-free peptide is often written simply as GHK, while the copper-bound form is written GHK-Cu.
| Property | Value | Notes |
|---|---|---|
| INCI name | Copper tripeptide-1 | Standard designation on cosmetic ingredient labels |
| Peptide sequence | Gly-His-Lys | Three-residue ligand; binding occurs at the histidine side chain |
| Metal-to-peptide ratio | 1 to 1 | One copper(II) ion per peptide unit |
| Appearance | Blue to violet powder | Colour arises from copper-to-peptide electronic transitions |
| Water solubility | Freely soluble | Commonly formulated in aqueous or water-alcohol systems |
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, its terminal amino group, and a deprotonated amide nitrogen, creating a stable chelate ring. The resulting complex carries a distinctive blue to blue-violet color, which arises from copper d-d electronic transitions. In the solid state it is usually handled as a powder, while in solution the complex can dissociate and re-form depending on pH and competing ligands. The name copper tripeptide-1 is widely used in ingredient listings.
The tripeptide was first isolated from a human plasma filtrate in 1973 during studies of tissue repair factors. Later work detected the free peptide and its copper complex in saliva, urine, and wound fluid, suggesting a natural role in tissue remodeling. Plasma concentrations reported in early literature decline with age, a pattern often cited in discussions of skin aging. Whether these endogenous levels are directly functional or largely incidental remains an open question. The peptide sequence is conserved across mammalian species.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide sequence is often abbreviated Gly-His-Lys, and the copper is bound through the histidine imidazole nitrogen and adjacent peptide nitrogens. The complex is frequently described as a 1:1 peptide-to-copper species. It occurs naturally in human plasma, saliva, and urine at low concentrations. Its endogenous levels have been reported to decline with age, although the precise physiological role of that change remains an open question.
Research interest in GHK-Cu centers on its ability to deliver copper and to influence cellular processes in laboratory models. In cell culture and animal studies, the complex has been linked to collagen synthesis, antioxidant enzyme activity, and expression of genes associated with tissue remodeling. These effects are not equivalent to proven clinical outcomes. The mechanisms proposed include copper transfer to cuproenzymes, modulation of growth factor signaling, and interactions with extracellular matrix components. How much of the observed activity depends on intact GHK-Cu versus free copper or free peptide is not fully resolved.
The compound entered scientific literature in the 1970s, when plasma factors with copper-binding activity were isolated and characterized. Later work expanded into wound healing, skin biology, and cosmetic formulation, where copper tripeptide-1 became a recognized ingredient name. Most published studies remain preclinical or small-scale, and findings are often reported in specialized dermatology or peptide journals. Regulatory treatment varies: some jurisdictions allow it as a cosmetic ingredient, while research-grade material is sold for laboratory use. Questions about optimal delivery, target tissues, and long-term effects continue to be investigated rather than settled.
The peptide sequence places a histidine in the middle, and this residue dominates metal binding. Copper(II) coordinates through the imidazole nitrogen of histidine and the terminal amino group, forming a stable chelate ring system. Loss of the copper ion leaves the free tripeptide, which has different solubility and reactivity. This structural detail matters because assays that measure only the peptide backbone can miss whether copper is still bound to it.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
On 15 June, US vice president JD Vance announced that the memorandum was digitally signed by both countries the previous day. On 17 June, Trump and Iranian president Masoud Pezeshkian signed the Islamabad Memorandum to end the war, with Trump signing it during dinner with French president Emmanuel Macron at the Palace of Versailles after the G7 summit. On 18 June, Pakistan stated that the signing of the memorandum implies Tehran will reopen the Strait of Hormuz "instantly" and the American blockade will end "immediately." CENTCOM announced that it had removed the naval blockade. On 19 June, Trump announced a renewed ceasefire between Israel and Hezbollah in the 2026 Lebanon war, facilitated by the US, Qatar, and Iran. However, on 20 June, Hezbollah announced an attack on Israeli forces trying to capture Ali al-Taher in Nabatieh, while Israel continued to strike southern Lebanon.
Leather is a strong, flexible and durable material obtained from the tanning, or chemical treatment, of animal skins and hides to prevent decay. The most common leathers come from cattle, sheep, goats, equine animals, buffalo, pigs and hogs, ostriches, and aquatic animals such as seals and alligators. Leather can be used to make a variety of items, including clothing, footwear, handbags, furniture, tools and sports equipment, and lasts for decades. Leather making has been practiced for more than 7,000 years and the leading producers of leather today are China and India. Critics of tanneries claim that they engage in unsustainable practices that pose health hazards to the people and the environment near them.
If oxygen saturation in sea water drops to about 1–10% it can be fatal for Octopus vulgaris depending on the weight of the animal and the water temperature. Ventilation may increase to pump more water carrying oxygen across the gills but due to receptors found on the gills the energy use and oxygen uptake remains at a stable rate. The high percent of oxygen extraction allows for energy saving and benefits for living in an area of low oxygen concentration. Water is pumped into the mantle cavity of the octopus, where it comes into contact with the internal gills. The water has a high concentration of oxygen compared to the blood returning from the veins, so oxygen diffuses into the blood. The tissues and muscles of the octopus use oxygen and release carbon dioxide when breaking down glucose in the Krebs cycle. The carbon dioxide then dissolves into the blood or combines with water to form carbonic acid, which decreases blood pH. The Bohr effect explains why oxygen concentrations are lower in venous blood than arterial blood and why oxygen diffuses into the bloodstream. The rate of diffusion is affected by the distance the oxygen has to travel from the water to the bloodstream as indicated by Fick's laws of diffusion. Fick's laws explain why the gills of the octopus contain many small folds that are highly vascularized. They increase surface area, thus also increase the rate of diffusion. The capillaries that line the folds of the gill epithelium have a very thin tissue barrier (10 μm), which allows for fast, easy diffusion of the oxygen into the blood.
Two polypeptides. A large subunit of 104 amino acids (sequence TMWGTKWCGSGNEATDISELGYWSNLDSCCRTHDHCDNIPSGQTKYGLTNEGKYTMMNCKCETAFEQCLRNVTGGMEGPAAGFVRKTYFDLYGNGCYNVQCPSQ) and a smaller one of 27 amino acids (sequence SEECPDGVATYTGEAGYGAWAINKLNG). Subunits are linked by a disulfide bond. Phospholipase A2 (PLA2) activity on the large subunit. The molecular weight of the toxin is 15 kDa. Like IpTxa, IpTxi acts on RyR. When an action potential reaches the muscle, RyR channels open and Ca2+ becomes available in the cell to induce contraction. The presence of Ca2+ induces the large subunit of IpTxi to hydrolyze the Sn2 fatty acyl bond from the membrane of the sarcoplasmatic reticulum. This process is executed by PLA2 activity. The freed fatty acids bind to the RyR itself or to a closely associated protein linked to gating. Binding of the RyR induces blocking of the channel. When the concentration of free fatty acids is low there will be an incomplete block of RyR; higher concentrations will give a complete block. Because IpTxi also works on the RyR channels of the heart muscles, it could potentially be used as a drug against arrhythmia. This has not yet been proven, and must be studied in vivo first.
Sources: en.wikipedia.org
18 And she revealed her whorings, and she revealed her nakedness, and so I turned from her just as I turned from her sister. 19 Yet she increased her whorings, recalling the days of her childhood when she was prostituted in the land of Egypt. 20 And she lusted after her male lovers whose genitalia were the genitalia of male donkeys and their seminal emission was the seminal emission of horses. Ezekiel 23:18–20 Lexham English Bible
Many of the former Varian employees now honor Russell Varian's legacy of innovation by funding the Varian Young Investigator Award that recognizes early career investigators in NMR that make significant advancements in instrument development.
== History == The Roman anatomist Galen commented on Hippocrates' work, classifying teeth as bones, noting their distinct characteristics compared to other bones. He was the first to discover nerves in teeth and identified seven cranial nerves in his research.
Sources: en.wikipedia.org
It is a complex of a three-amino-acid peptide, glycine, histidine and lysine, bound to a single copper(II) ion. The metal is held mainly by the histidine side chain and the peptide backbone. Most commercial material is supplied as an acetate salt rather than as the free complex.
The free peptide was reported in 1973 by Loren Pickart, who isolated it from human plasma. Its copper-binding behaviour was characterised over the following years. The metal-bound form has been the subject of most later research.
Yes. Copper tripeptide-1 is the name used in cosmetic ingredient labelling, while GHK-Cu is the shorthand found in the scientific literature. Both refer to the same peptide-copper complex, and the two terms are interchangeable in most technical documents.
It is the copper(II) complex of the tripeptide glycyl-L-histidyl-lysine, a sequence of three amino acids. The copper ion is held by the histidine imidazole, the terminal amino group, and an amide nitrogen. The bound form is distinct from the free peptide in charge, color, and stability.